SPG21 (NM_001127889) Human Mass Spec Standard

SKU
PH325431
SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225431]
Predicted MW 35 kDa
Protein Sequence
Protein Sequence
>RC225431 protein sequence
Red=Cloning site Green=Tags(s)

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG
YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT
SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE
PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK
YAAIDPSMVSAEELEVQKGSLGISQEEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121361
RefSeq Size 1658
RefSeq ORF 924
Synonyms ABHD21; ACP33; BM-019; GL010; MAST
Locus ID 51324
UniProt ID Q9NZD8
Cytogenetics 15q22.31
Summary The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Write Your Own Review
You're reviewing:SPG21 (NM_001127889) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300071 SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_057714) 10 ug
$3,255.00
LC413881 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426876 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426877 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413881 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1 100 ug
$436.00
LY426876 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2 100 ug
$436.00
LY426877 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 3 100 ug
$436.00
TP300071 Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325431 Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.