SPG21 (NM_016630) Human Recombinant Protein

SKU
TP300071
Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200071 protein sequence
Red=Cloning site Green=Tags(s)

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG
YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT
SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE
PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK
YAAIDPSMVSAEELEVQKGSLGISQEEQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057714
Locus ID 51324
UniProt ID Q9NZD8
Cytogenetics 15q22.31
RefSeq Size 1839
RefSeq ORF 924
Synonyms ABHD21; ACP33; BM-019; GL010; MAST
Summary The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Write Your Own Review
You're reviewing:SPG21 (NM_016630) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300071 SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_057714) 10 ug
$3,255.00
PH325431 SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) 10 ug
$3,255.00
LC413881 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426876 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426877 SPG21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413881 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1 100 ug
$436.00
LY426876 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2 100 ug
$436.00
LY426877 Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 3 100 ug
$436.00
TP325431 Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.