SPG21 (NM_016630) Human Recombinant Protein
SKU
TP300071
Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200071 protein sequence
Red=Cloning site Green=Tags(s) MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK YAAIDPSMVSAEELEVQKGSLGISQEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057714 |
Locus ID | 51324 |
UniProt ID | Q9NZD8 |
Cytogenetics | 15q22.31 |
RefSeq Size | 1839 |
RefSeq ORF | 924 |
Synonyms | ABHD21; ACP33; BM-019; GL010; MAST |
Summary | The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300071 | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_057714) | 10 ug |
$3,255.00
|
|
PH325431 | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) | 10 ug |
$3,255.00
|
|
LC413881 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426876 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426877 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY413881 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1 | 100 ug |
$436.00
|
|
LY426876 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2 | 100 ug |
$436.00
|
|
LY426877 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 3 | 100 ug |
$436.00
|
|
TP325431 | Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.