KCTD6 (NM_001128214) Human Mass Spec Standard

SKU
PH325297
KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_001121686)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225297]
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC225297 protein sequence
Red=Cloning site Green=Tags(s)

MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN
FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII
TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV
HHMSERANENTVEHNWTFCRLARKTDD

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121686
RefSeq Size 1566
RefSeq ORF 711
Synonyms KCASH3
Locus ID 200845
UniProt ID Q8NC69
Cytogenetics 3p14.3
Summary Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB) (PubMed:21472142). Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation (PubMed:22573887).[UniProtKB/Swiss-Prot Function]
Protein Families Ion Channels: Other
Write Your Own Review
You're reviewing:KCTD6 (NM_001128214) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305633 KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_699162) 10 ug
$3,255.00
LC407050 KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426928 KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407050 Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1 100 ug
$436.00
LY426928 Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 100 ug
$436.00
TP305633 Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325297 Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.