KCTD6 (NM_001128214) Human Tagged ORF Clone

SKU
RC225297
KCTD6 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD6
Synonyms KCASH3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225297 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAATGGAGACTGGGGCTATATGATGACTGACCCAGTCACATTAAATGTAGGTGGACACTTGTATA
CAACGTCTCTCACCACATTGACGCGTTACCCGGATTCCATGCTTGGAGCTATGTTTGGGGGGGACTTCCC
CACAGCTCGAGACCCTCAAGGCAATTACTTTATTGATCGAGATGGACCTCTTTTCCGATATGTCCTCAAC
TTCTTAAGAACTTCAGAATTGACCTTACCGTTGGATTTTAAGGAATTTGATCTGCTTCGGAAAGAAGCAG
ATTTTTACCAGATTGAGCCCTTGATTCAGTGTCTCAATGATCCTAAGCCTTTGTATCCCATGGATACTTT
TGAAGAAGTTGTGGAGCTGTCTAGTACTCGGAAGCTTTCTAAGTACTCCAACCCAGTGGCTGTCATCATA
ACGCAACTAACCATCACCACTAAGGTCCATTCCTTACTAGAAGGCATCTCAAATTATTTTACCAAGTGGA
ATAAGCACATGATGGACACCAGAGACTGCCAGGTTTCCTTTACTTTTGGACCCTGTGATTATCACCAGGA
AGTTTCTCTTAGGGTCCACCTGATGGAATACATTACAAAACAAGGTTTCACGATCCGCAACACCCGGGTG
CATCACATGAGTGAGCGGGCCAATGAAAACACAGTGGAGCACAACTGGACTTTCTGTAGGCTAGCCCGGA
AGACAGACGAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225297 protein sequence
Red=Cloning site Green=Tags(s)

MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN
FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII
TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV
HHMSERANENTVEHNWTFCRLARKTDD

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001128214
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001128214.2
RefSeq Size 1566 bp
RefSeq ORF 714 bp
Locus ID 200845
UniProt ID Q8NC69
Cytogenetics 3p14.3
Protein Families Ion Channels: Other
MW 27.6 kDa
Summary Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB) (PubMed:21472142). Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation (PubMed:22573887).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KCTD6 (NM_001128214) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225297L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC225297L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2, mGFP tagged 10 ug
$600.00
RG225297 KCTD6 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 10 ug
$500.00
SC322912 KCTD6 (untagged)-Human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.