SYCE2 (NM_001105578) Human Mass Spec Standard

SKU
PH325261
SYCE2 MS Standard C13 and N15-labeled recombinant protein (NP_001099048)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225261]
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC225261 representing NM_001105578
Red=Cloning site Green=Tags(s)

MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL
QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS
HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV
QTNRDGEC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001099048
RefSeq ORF 654
Synonyms CESC1
Locus ID 256126
UniProt ID Q6PIF2
Cytogenetics 19p13.13
Summary The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:SYCE2 (NM_001105578) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC426288 SYCE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426288 Transient overexpression lysate of synaptonemal complex central element protein 2 (SYCE2) 100 ug
$436.00
TP325261 Recombinant protein of human synaptonemal complex central element protein 2 (SYCE2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.