SYCE2 Rabbit Polyclonal Antibody

SKU TA334098

Rabbit Polyclonal Anti-SYCE2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYCE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYCE2. Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: synaptonemal complex central element protein 2
• Database Link:
  NP_001099048
  Q6PIF2
• Background: SYCE2 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. SYCE2 requires SYCP1 in order to be incorporated into the central element and may have a role in the synaptonemal complex assembly, stabilization and recombination.
• Synonyms: CESC1
• Note: Immunogen sequence homology: Human: 100%

Reference Data