SYCE2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SYCE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYCE2. Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 23 kDa |
| Gene Name | synaptonemal complex central element protein 2 |
| Database Link | |
| Background | SYCE2 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. SYCE2 requires SYCP1 in order to be incorporated into the central element and may have a role in the synaptonemal complex assembly, stabilization and recombination. |
| Synonyms | CESC1 |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
