C7orf50 (NM_001134396) Human Mass Spec Standard

SKU
PH325216
C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225216]
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC225216 protein sequence
Red=Cloning site Green=Tags(s)

MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL
KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH
FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001127868
RefSeq Size 1282
RefSeq ORF 582
Synonyms YCR016W
Locus ID 84310
UniProt ID Q9BRJ6
Cytogenetics 7p22.3
Write Your Own Review
You're reviewing:C7orf50 (NM_001134396) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302632 C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_115726) 10 ug
$3,255.00
PH325215 C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127867) 10 ug
$3,255.00
LC410187 C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427414 C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427415 C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410187 Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 1 100 ug
$436.00
LY427414 Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 2 100 ug
$436.00
LY427415 Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 3 100 ug
$436.00
TP302632 Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 1, 20 µg 20 ug
$737.00
TP325215 Purified recombinant protein of Homo sapiens chromosome 7 open reading frame 50 (C7orf50), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325216 Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.