C7orf50 (NM_032350) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202632] |
Predicted MW | 22.1 kDa |
Protein Sequence |
Protein Sequence
>RC202632 protein sequence
Red=Cloning site Green=Tags(s) MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_115726 |
RefSeq Size | 1311 |
RefSeq ORF | 582 |
Synonyms | YCR016W |
Locus ID | 84310 |
UniProt ID | Q9BRJ6 |
Cytogenetics | 7p22.3 |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH325215 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127867) | 10 ug |
$3,255.00
|
|
PH325216 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868) | 10 ug |
$3,255.00
|
|
LC410187 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427414 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427415 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410187 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 1 | 100 ug |
$436.00
|
|
LY427414 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 2 | 100 ug |
$436.00
|
|
LY427415 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 3 | 100 ug |
$436.00
|
|
TP302632 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP325215 | Purified recombinant protein of Homo sapiens chromosome 7 open reading frame 50 (C7orf50), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP325216 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.