PHR1 (PLEKHB1) (NM_001130035) Human Mass Spec Standard

SKU
PH325204
PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_001123507)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225204]
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC225204 representing NM_001130035
Red=Cloning site Green=Tags(s)

MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEG
RSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPVRVYSPYQDYYEVVPPNAHEATYVRSYYG
PPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123507
RefSeq ORF 567
Synonyms KPL1; PHR1; PHRET1
Locus ID 58473
UniProt ID Q9UF11
Cytogenetics 11q13.4
Write Your Own Review
You're reviewing:PHR1 (PLEKHB1) (NM_001130035) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316627 PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_067023) 10 ug
$3,255.00
LC412039 PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427118 PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412039 Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1 100 ug
$436.00
LY427118 Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4 100 ug
$436.00
TP316627 Recombinant protein of human pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325204 Purified recombinant protein of Homo sapiens pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.