PHR1 (PLEKHB1) (NM_021200) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC216627] |
Predicted MW | 27 kDa |
Protein Sequence |
Protein Sequence
>RC216627 representing NM_021200
Red=Cloning site Green=Tags(s) MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHF NVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPAPAGATVPPR SRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVRED PCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_067023 |
RefSeq Size | 2402 |
RefSeq ORF | 729 |
Synonyms | KPL1; PHR1; PHRET1 |
Locus ID | 58473 |
UniProt ID | Q9UF11 |
Cytogenetics | 11q13.4 |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH325204 | PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_001123507) | 10 ug |
$3,255.00
|
|
LC412039 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427118 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412039 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1 | 100 ug |
$436.00
|
|
LY427118 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4 | 100 ug |
$436.00
|
|
TP316627 | Recombinant protein of human pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP325204 | Purified recombinant protein of Homo sapiens pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.