MAGEB1 (NM_177404) Human Mass Spec Standard

SKU
PH324906
MAGEB1 MS Standard C13 and N15-labeled recombinant protein (NP_796379)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224906]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC224906
Blue=ORF Red=Cloning site Green=Tag(s)

MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTT
AAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVV
DEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGV
IFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRA
YAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSH
PM

myc-FLAG tag

Recombinant protein using RC224906 also available, TP324906
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_796379
RefSeq Size 1708
RefSeq ORF 1041
Synonyms CT3.1; DAM10; MAGE-Xp; MAGEL1
Locus ID 4112
UniProt ID P43366
Cytogenetics Xp21.2
Summary This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MAGEB1 (NM_177404) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406154 MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406157 MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419376 MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406154 Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 2 100 ug
$436.00
LY406157 Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 3 100 ug
$436.00
LY419376 Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 1 100 ug
$436.00
TP324906 Recombinant protein of human melanoma antigen family B, 1 (MAGEB1), transcript variant 2, 20 µg 20 ug
$737.00
TP760698 Purified recombinant protein of Human melanoma antigen family B, 1 (MAGEB1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.