MAGEB1 (NM_177404) Human Recombinant Protein
CAT#: TP324906
Recombinant protein of human melanoma antigen family B, 1 (MAGEB1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC224906
Blue=ORF Red=Cloning site Green=Tag(s) MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTT AAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVV DEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGV IFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRA YAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSH PM myc-FLAG tag Recombinant protein using RC224906 also available, TP324906 |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_796379 |
Locus ID | 4112 |
UniProt ID | P43366 |
Cytogenetics | Xp21.2 |
Refseq Size | 1708 |
Refseq ORF | 1041 |
Synonyms | CT3.1; DAM10; MAGE-Xp; MAGEL1 |
Summary | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406154 | MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406157 | MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419376 | MAGEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406154 | Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 2 |
USD 436.00 |
|
LY406157 | Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 3 |
USD 436.00 |
|
LY419376 | Transient overexpression lysate of melanoma antigen family B, 1 (MAGEB1), transcript variant 1 |
USD 436.00 |
|
PH324906 | MAGEB1 MS Standard C13 and N15-labeled recombinant protein (NP_796379) |
USD 3,255.00 |
|
TP760698 | Purified recombinant protein of Human melanoma antigen family B, 1 (MAGEB1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review