MCG10 (PCBP4) (NM_033010) Human Mass Spec Standard

SKU
PH324895
PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127503)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224895]
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC224895 protein sequence
Red=Cloning site Green=Tags(s)

MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTA
AVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD
LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTP
AEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ
AEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPY
AISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_127503
RefSeq Size 1982
RefSeq ORF 1209
Synonyms CBP; LIP4; MCG10
Locus ID 57060
UniProt ID P57723
Cytogenetics 3p21.2
Summary This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MCG10 (PCBP4) (NM_033010) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300749 PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127501) 10 ug
$3,255.00
LC403218 PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409760 PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429839 PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403218 Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 3 100 ug
$436.00
LY409760 Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 100 ug
$436.00
LY429839 Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 100 ug
$436.00
TP300749 Recombinant protein of human poly(rC) binding protein 4 (PCBP4), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324895 Purified recombinant protein of Homo sapiens poly(rC) binding protein 4 (PCBP4), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.