UBE2S (NM_014501) Human Mass Spec Standard

SKU
PH324851
UBE2S MS Standard C13 and N15-labeled recombinant protein (NP_055316)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224851]
Predicted MW 23.7 kDa
Protein Sequence
Protein Sequence
>RC224851 representing NM_014501
Red=Cloning site Green=Tags(s)

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF
PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN
YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK
KKTDKKRALRRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055316
RefSeq Size 890
RefSeq ORF 666
Synonyms E2-EPF; E2EPF; EPF5
Locus ID 27338
UniProt ID Q16763
Cytogenetics 19q13.42
Summary This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2S (NM_014501) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402342 UBE2S HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402342 Transient overexpression lysate of ubiquitin-conjugating enzyme E2S (UBE2S) 100 ug
$436.00
TP324851 Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720259 Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S) 10 ug
$155.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.