OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2S (NM_014501) Human Mass Spec Standard

Be the first to review this product
SKU
PH324851
UBE2S MS Standard C13 and N15-labeled recombinant protein (NP_055316)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505187 UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3) 100 ul
$447.00
LY402342 Transient overexpression lysate of ubiquitin-conjugating enzyme E2S (UBE2S) (as WB positive control) 100 ug
$436.00

Other products for "UBE2S or NM_014501"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224851
Predicted MW 23.7 kDa
Protein Sequence
Protein Sequence
>RC224851 representing NM_014501
Red=Cloning site Green=Tags(s)

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF
PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN
YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK
KKTDKKRALRRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055316
RefSeq Size 890
RefSeq ORF 666
Synonyms E2-EPF; E2EPF; EPF5
Locus ID 27338
UniProt ID Q16763
Cytogenetics 19q13.42
Summary This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2S" proteins (4)
SKU Description Size Price
LC402342 Lyophilized UBE2S HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402342 Transient overexpression lysate of ubiquitin-conjugating enzyme E2S (UBE2S) (as WB positive control) 100 ug
$436.00
TP324851 Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S), 20 µg 20 ug
$867.00
TP720259 Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products