POLR2J2 (NM_032959) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224755] |
Predicted MW | 12.9 kDa |
Protein Sequence |
Protein Sequence
>RC224755 representing NM_032959
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_116581 |
RefSeq Size | 1727 |
RefSeq ORF | 345 |
Synonyms | HRPB11B; POLR2J3; RPB11b1; RPB11b2 |
Locus ID | 246721 |
UniProt ID | Q9GZM3 |
Cytogenetics | 7q22.1 |
Summary | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC409843 | POLR2J2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409843 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) | 100 ug |
$436.00
|
|
TP324755 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760696 | Purified recombinant protein of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.