Clathrin light chain (CLTB) (NM_007097) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224622] |
Predicted MW | 25 kDa |
Protein Sequence |
Protein Sequence
>RC224622 representing NM_007097
Red=Cloning site Green=Tags(s) MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK DVSRLRSVLMSLKQTPLSR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009028 |
RefSeq Size | 1184 |
RefSeq ORF | 687 |
Synonyms | LCB |
Locus ID | 1212 |
UniProt ID | P09497 |
Cytogenetics | 5q35.2 |
Summary | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis, Huntington's disease, Lysosome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400697 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416210 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400697 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 1 | 100 ug |
$436.00
|
|
LY416210 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 2 | 100 ug |
$436.00
|
|
TP324622 | Recombinant protein of human clathrin, light chain (Lcb) (CLTB), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.