Clathrin light chain (CLTB) (NM_007097) Human Tagged ORF Clone

SKU
RC224622
CLTB (Myc-DDK-tagged)-Human clathrin, light chain B (CLTB), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Clathrin light chain
Synonyms LCB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224622 representing NM_007097
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATGACTTTGGCTTCTTCTCGTCGTCGGAGAGCGGTGCCCCGGAGGCGGCGGAGGAGGACCCGG
CGGCCGCCTTCCTGGCCCAGCAGGAGAGCGAGATTGCAGGCATAGAGAACGACGAGGGCTTCGGGGCACC
TGCCGGCAGCCATGCGGCCCCCGCGCAGCCGGGCCCCACGAGTGGGGCTGGTTCTGAGGACATGGGGACC
ACAGTCAATGGAGATGTGTTTCAGGAGGCCAACGGTCCTGCTGATGGCTACGCAGCCATTGCCCAGGCTG
ACAGGCTGACCCAGGAGCCTGAGAGCATCCGCAAGTGGCGAGAGGAGCAGAGGAAACGGCTGCAAGAGCT
GGATGCTGCATCTAAGGTCACGGAACAGGAATGGCGGGAGAAGGCCAAGAAGGACCTGGAGGAGTGGAAC
CAGCGCCAGAGTGAACAAGTAGAGAAGAACAAGATCAACAACCGGATCGCTGACAAAGCATTCTACCAGC
AGCCAGATGCTGATATCATCGGCTACGTGGCATCCGAGGAGGCTTTCGTGAAGGAATCCAAGGAGGAGAC
CCCAGGCACAGAGTGGGAGAAGGTGGCCCAGCTATGTGACTTCAACCCCAAGAGCAGCAAGCAGTGCAAA
GATGTGTCCCGCCTGCGCTCGGTGCTCATGTCCCTGAAGCAGACGCCACTGTCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224622 representing NM_007097
Red=Cloning site Green=Tags(s)

MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT
TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN
QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK
DVSRLRSVLMSLKQTPLSR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007097
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007097.5
RefSeq Size 1184 bp
RefSeq ORF 690 bp
Locus ID 1212
UniProt ID P09497
Cytogenetics 5q35.2
Domains Clathrin_lg_ch
Protein Pathways Endocytosis, Huntington's disease, Lysosome
MW 25 kDa
Summary Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Clathrin light chain (CLTB) (NM_007097) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224622L3 Lenti ORF clone of Human clathrin, light chain B (CLTB), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC224622L4 Lenti ORF clone of Human clathrin, light chain B (CLTB), transcript variant 2, mGFP tagged 10 ug
$600.00
RG224622 CLTB (tGFP-tagged) - Human clathrin, light chain B (CLTB), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC109077 CLTB (untagged)-Human clathrin, light chain B (CLTB), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.