OriGene Logo

SOX21 (NM_007084) Human Mass Spec Standard

Be the first to review this product
SKU
PH324471
SOX21 MS Standard C13 and N15-labeled recombinant protein (NP_009015)
Size:
10 ug
  $3,255.00
3 Weeks*
Size
Bulk/Customize

Frequently Bought Together (1)

TA807817 SOX21 mouse monoclonal antibody,clone OTI7D5 100 ul
$447.00

Other products for "SOX21 or NM_007084"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224471
Predicted MW 28.4 kDa
Protein Sequence
Protein Sequence
>RC224471 representing NM_007084
Red=Cloning site Green=Tags(s)

MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK
EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAA
AAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAA
AAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009015
RefSeq Size 2537
RefSeq ORF 828
Synonyms SOX25
Locus ID 11166
UniProt ID Q9Y651
Cytogenetics 13q32.1
Summary SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM, Apr 2004]
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "196465" proteins (2)
SKU Description Size Price
TP324471 Recombinant protein of human SRY (sex determining region Y)-box 21 (SOX21), 20 µg 20 ug
$867.00
TP762001 Purified recombinant protein of Human SRY (sex determining region Y)-box 21 (SOX21),Met1-Ala140, with N-terminal His-Trx tag, expressed in E. coli, 50ug 50 ug
$261.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.