PD L2 (PDCD1LG2) (NM_025239) Human Mass Spec Standard

SKU
PH324141
PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224141]
Predicted MW 30.8 kDa
Protein Sequence
Protein Sequence
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s)

MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR
ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE
LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079515
RefSeq Size 1518
RefSeq ORF 819
Synonyms B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Locus ID 80380
UniProt ID Q9BQ51
Cytogenetics 9p24.1
Summary Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:PD L2 (PDCD1LG2) (NM_025239) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410802 PDCD1LG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410802 Transient overexpression lysate of programmed cell death 1 ligand 2 (PDCD1LG2) 100 ug
$436.00
TP324141 Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP700202 Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain expressed in human cells, 20 µg 20 ug
$867.00
TP700203 Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg 20 ug
$867.00
TP720737 Purified recombinant protein of Human programmed cell death 1 ligand 2 (PDCD1LG2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.