PD L2 (PDCD1LG2) (NM_025239) Human Tagged ORF Clone

SKU
RC224141
PDCD1LG2 (Myc-DDK-tagged)-Human programmed cell death 1 ligand 2 (PDCD1LG2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PD L2
Synonyms B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224141 representing NM_025239
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTTCCTCCTGCTAATGTTGAGCCTGGAATTGCAGCTTCACCAGATAGCAGCTTTATTCACAGTGA
CAGTCCCTAAGGAACTGTACATAATAGAGCATGGCAGCAATGTGACCCTGGAATGCAACTTTGACACTGG
AAGTCATGTGAACCTTGGAGCAATAACAGCCAGTTTGCAAAAGGTGGAAAATGATACATCCCCACACCGT
GAAAGAGCCACTTTGCTGGAGGAGCAGCTGCCCCTAGGGAAGGCCTCGTTCCACATACCTCAAGTCCAAG
TGAGGGACGAAGGACAGTACCAATGCATAATCATCTATGGGGTCGCCTGGGACTACAAGTACCTGACTCT
GAAAGTCAAAGCTTCCTACAGGAAAATAAACACTCACATCCTAAAGGTTCCAGAAACAGATGAGGTAGAG
CTCACCTGCCAGGCTACAGGTTATCCTCTGGCAGAAGTATCCTGGCCAAACGTCAGCGTTCCTGCCAACA
CCAGCCACTCCAGGACCCCTGAAGGCCTCTACCAGGTCACCAGTGTTCTGCGCCTAAAGCCACCCCCTGG
CAGAAACTTCAGCTGTGTGTTCTGGAATACTCACGTGAGGGAACTTACTTTGGCCAGCATTGACCTTCAA
AGTCAGATGGAACCCAGGACCCATCCAACTTGGCTGCTTCACATTTTCATCCCCTCCTGCATCATTGCTT
TCATTTTCATAGCCACAGTGATAGCCCTAAGAAAACAACTCTGTCAAAAGCTGTATTCTTCAAAAGACAC
AACAAAAAGACCTGTCACCACAACAAAGAGGGAAGTGAACAGTGCTATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s)

MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR
ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE
LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025239
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025239.2, NP_079515.1
RefSeq Size 1518 bp
RefSeq ORF 822 bp
Locus ID 80380
UniProt ID Q9BQ51
Cytogenetics 9p24.1
Domains IG
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 30.8 kDa
Summary Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PD L2 (PDCD1LG2) (NM_025239) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224141L1 Lenti ORF clone of Human programmed cell death 1 ligand 2 (PDCD1LG2), Myc-DDK-tagged 10 ug
$750.00
RC224141L2 Lenti ORF clone of Human programmed cell death 1 ligand 2 (PDCD1LG2), mGFP tagged 10 ug
$750.00
RC224141L3 Lenti ORF clone of Human programmed cell death 1 ligand 2 (PDCD1LG2), Myc-DDK-tagged 10 ug
$750.00
RC224141L4 Lenti ORF clone of Human programmed cell death 1 ligand 2 (PDCD1LG2), mGFP tagged 10 ug
$750.00
RG224141 PDCD1LG2 (tGFP-tagged) - Human programmed cell death 1 ligand 2 (PDCD1LG2) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC108873 PDCD1LG2 (untagged)-Human programmed cell death 1 ligand 2 (PDCD1LG2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.