BPGM (NM_001724) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223838] |
Predicted MW | 30 kDa |
Protein Sequence |
Protein Sequence
>RC223838 protein sequence
Red=Cloning site Green=Tags(s) MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001715 |
RefSeq Size | 1800 |
RefSeq ORF | 777 |
Synonyms | DPGM; ECYT8 |
Locus ID | 669 |
UniProt ID | P07738 |
Cytogenetics | 7q33 |
Summary | 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302105 | BPGM MS Standard C13 and N15-labeled recombinant protein (NP_954655) | 10 ug |
$3,255.00
|
|
LC404682 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419780 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430797 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404682 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 | 100 ug |
$436.00
|
|
LY419780 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 | 100 ug |
$436.00
|
|
TP302105 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323838 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720896 | Purified recombinant protein of Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.