BPGM (NM_001724) Human Tagged ORF Clone

SKU
RC223838
BPGM (Myc-DDK-tagged)-Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BPGM
Synonyms DPGM; ECYT8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223838 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAGTACAAACTTATTATGTTAAGACATGGAGAGGGTGCTTGGAATAAGGAGAACCGTTTTTGTA
GCTGGGTGGATCAGAAACTCAACAGCGAAGGAATGGAGGAAGCTCGGAACTGTGGGAAGCAACTCAAAGC
GTTAAACTTTGAGTTTGATCTTGTATTCACATCTGTCCTTAATCGGTCCATTCACACAGCCTGGCTGATC
CTGGAAGAGCTAGGCCAGGAATGGGTGCCTGTGGAAAGCTCCTGGCGTCTAAATGAGCGTCACTATGGGG
CCTTGATCGGTCTCAACAGGGAGCAGATGGCTTTGAATCATGGTGAAGAACAAGTGAGGCTCTGGAGAAG
AAGCTACAATGTAACCCCGCCTCCCATTGAGGAGTCTCATCCTTACTACCAAGAAATCTACAACGACCGG
AGGTATAAAGTATGCGATGTGCCCTTGGATCAACTGCCACGGTCGGAAAGCTTAAAGGATGTTCTGGAGA
GACTCCTTCCCTATTGGAATGAAAGGATTGCTCCCGAAGTATTACGTGGCAAAACCATTCTGATATCTGC
TCATGGAAATAGCAGTAGGGCACTCCTAAAACACCTGGAAGGTATCTCAGATGAAGACATCATCAACATT
ACTCTTCCTACTGGAGTCCCCATTCTTCTGGAATTGGATGAAAACCTGCGTGCTGTTGGGCCTCATCAGT
TCCTGGGTGACCAAGAGGCGATCCAAGCAGCCATTAAGAAAGTAGAAGATCAAGGAAAAGTGAAACAAGC
TAAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223838 protein sequence
Red=Cloning site Green=Tags(s)

MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI
LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR
RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI
TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001724
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001724.5
RefSeq Size 1800 bp
RefSeq ORF 780 bp
Locus ID 669
UniProt ID P07738
Cytogenetics 7q33
Domains PGAM
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways
MW 30 kDa
Summary 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:BPGM (NM_001724) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223838L3 Lenti ORF clone of Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC223838L4 Lenti ORF clone of Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1, mGFP tagged 10 ug
$600.00
RG223838 BPGM (tGFP-tagged) - Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 10 ug
$500.00
SC119062 BPGM (untagged)-Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.