LXR alpha (NR1H3) (NM_005693) Human Mass Spec Standard

SKU
PH323767
NR1H3 MS Standard C13 and N15-labeled recombinant protein (NP_005684)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223767]
Predicted MW 50.2 kDa
Protein Sequence
Protein Sequence
>RC223767 representing NM_005693
Red=Cloning site Green=Tags(s)

MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA
EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC
PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ
LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005684
RefSeq Size 1528
RefSeq ORF 1341
Synonyms LXR-a; LXRA; RLD-1
Locus ID 10062
UniProt ID Q13133
Cytogenetics 11p11.2
Summary The protein encoded by this gene belongs to the NR1 subfamily of the nuclear receptor superfamily. The NR1 family members are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. This protein is highly expressed in visceral organs, including liver, kidney and intestine. It forms a heterodimer with retinoid X receptor (RXR), and regulates expression of target genes containing retinoid response elements. Studies in mice lacking this gene suggest that it may play an important role in the regulation of cholesterol homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways PPAR signaling pathway
Write Your Own Review
You're reviewing:LXR alpha (NR1H3) (NM_005693) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401738 NR1H3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401738 Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1 100 ug
$665.00
TP323767 Recombinant protein of human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.