EVA1 (MPZL2) (NM_144765) Human Mass Spec Standard

SKU
PH323753
MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_658911)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223753]
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC223753 protein sequence
Red=Cloning site Green=Tags(s)

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG
GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL
SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY
LEDTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_658911
RefSeq Size 1396
RefSeq ORF 645
Synonyms DFNB111; EVA; EVA1
Locus ID 10205
UniProt ID O60487
Cytogenetics 11q23.3
Summary Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:EVA1 (MPZL2) (NM_144765) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304628 MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_005788) 10 ug
$3,255.00
LC403409 MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417083 MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403409 Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 2 100 ug
$436.00
LY417083 Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 1 100 ug
$436.00
TP304628 Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1, 20 µg 20 ug
$737.00
TP323753 Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.