EVA1 (MPZL2) (NM_144765) Human Recombinant Protein

SKU
TP323753
Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223753 protein sequence
Red=Cloning site Green=Tags(s)

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG
GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL
SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY
LEDTD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_658911
Locus ID 10205
UniProt ID O60487
Cytogenetics 11q23.3
RefSeq Size 1396
RefSeq ORF 645
Synonyms DFNB111; EVA; EVA1
Summary Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:EVA1 (MPZL2) (NM_144765) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304628 MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_005788) 10 ug
$3,255.00
PH323753 MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_658911) 10 ug
$3,255.00
LC403409 MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417083 MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403409 Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 2 100 ug
$436.00
LY417083 Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 1 100 ug
$436.00
TP304628 Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.