OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Mass Spec Standard

Be the first to review this product
SKU
PH323540
PPP1R12A MS Standard C13 and N15-labeled recombinant protein (NP_002471)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380234 PPP1R12A Rabbit polyclonal Antibody
100 ul
$410.00
LY400883 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "Myosin Phosphatase or NM_002480"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223540
Predicted MW 117 kDa
Protein Sequence
Protein Sequence
>RC223540 representing NM_002480
Red=Cloning site Green=Tags(s)

MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYAN
VDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGD
TPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKG
YTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYL
EELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKK
DESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSLDNKEKEKDSK
GTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQD
DLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAV
TIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVT
LTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYR
PVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGS
YSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLL
EMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSKKKKKKLDSRLRPRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002471
RefSeq Size 4613
RefSeq ORF 3132
Synonyms GUBS; M130; MBS; MYPT1
Locus ID 4659
UniProt ID O14974
Cytogenetics 12q21.2-q21.31
Summary Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2009
Protein Families Druggable Genome
Protein Pathways Focal adhesion, Long-term potentiation, Regulation of actin cytoskeleton, Vascular smooth muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Myosin Phosphatase" proteins (7)
SKU Description Size Price
PH327493 PPP1R12A MS Standard C13 and N15-labeled recombinant protein (NP_001137357) 10 ug
$3,360.00
LC400883 Lyophilized PPP1R12A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428392 Lyophilized PPP1R12A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400883 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY428392 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP323540 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 1, 20 µg 20 ug
$867.00
TP327493 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products