GPLD1 (NM_177483) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223455] |
Predicted MW | 17.3 kDa |
Protein Sequence |
Protein Sequence
>RC223455 representing NM_177483
Red=Cloning site Green=Tags(s) MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_803436 |
RefSeq Size | 1096 |
RefSeq ORF | 528 |
Synonyms | GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1 |
Locus ID | 2822 |
UniProt ID | P80108 |
Cytogenetics | 6p22.3 |
Summary | Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317578 | GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_001494) | 10 ug |
$3,255.00
|
|
LC406093 | GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419906 | GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY406093 | Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 | 100 ug |
$436.00
|
|
LY419906 | Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1 | 100 ug |
$665.00
|
|
TP317578 | Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP323455 | Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.