OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPLD1 (NM_177483) Human Mass Spec Standard

Be the first to review this product
SKU
PH323455
GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376713 GPLD1 Rabbit polyclonal Antibody
100 ul
$410.00
LY406093 Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "GPLD1 or NM_177483"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223455
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC223455 representing NM_177483
Red=Cloning site Green=Tags(s)

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG
FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_803436
RefSeq Size 1096
RefSeq ORF 528
Synonyms GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1
Locus ID 2822
UniProt ID P80108
Cytogenetics 6p22.3
Summary Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPLD1" proteins (7)
SKU Description Size Price
PH317578 GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_001494) 10 ug
$3,360.00
LC406093 Lyophilized GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419906 Lyophilized GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406093 Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419906 Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP317578 Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1, 20 µg 20 ug
$737.00
TP323455 Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products