GPLD1 (NM_177483) Human Mass Spec Standard

SKU
PH323455
GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223455]
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC223455 representing NM_177483
Red=Cloning site Green=Tags(s)

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG
FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_803436
RefSeq Size 1096
RefSeq ORF 528
Synonyms GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1
Locus ID 2822
UniProt ID P80108
Cytogenetics 6p22.3
Summary Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Write Your Own Review
You're reviewing:GPLD1 (NM_177483) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317578 GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_001494) 10 ug
$3,255.00
LC406093 GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419906 GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406093 Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 100 ug
$436.00
LY419906 Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1 100 ug
$665.00
TP317578 Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1, 20 µg 20 ug
$737.00
TP323455 Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.