INDOL1 (IDO2) (NM_194294) Human Mass Spec Standard

SKU
PH323337
IDO2 MS Standard C13 and N15-labeled recombinant protein (NP_919270)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223337]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC223337 representing NM_194294
Red=Cloning site Green=Tags(s)

MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAH
QLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPI
LVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQ
EALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGS
AAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCV
QALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919270
RefSeq Size 2294
RefSeq ORF 1260
Synonyms INDOL1
Locus ID 169355
UniProt ID Q6ZQW0
Cytogenetics 8p11.21
Summary Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:INDOL1 (IDO2) (NM_194294) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403659 IDO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403659 Transient overexpression lysate of indoleamine 2,3-dioxygenase 2 (IDO2) 100 ug
$665.00
TP323337 Recombinant protein of human indoleamine 2,3-dioxygenase 2 (IDO2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.