OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

INDOL1 (IDO2) (NM_194294) Human Mass Spec Standard

Be the first to review this product
SKU
PH323337
IDO2 MS Standard C13 and N15-labeled recombinant protein (NP_919270)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501378 IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4) 100 ul
$447.00
LY403659 Transient overexpression lysate of indoleamine 2,3-dioxygenase 2 (IDO2) (as WB positive control) 100 ug
$665.00

Other products for "INDOL1 or NM_194294"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223337
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC223337 representing NM_194294
Red=Cloning site Green=Tags(s)

MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAH
QLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPI
LVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQ
EALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGS
AAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCV
QALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919270
RefSeq Size 2294
RefSeq ORF 1260
Synonyms INDOL1
Locus ID 169355
UniProt ID Q6ZQW0
Cytogenetics 8p11.21
Summary Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 PubMed 17499941).supplied by OMIM, Feb 2011
Protein Pathways Metabolic pathways, Tryptophan metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "INDOL1" proteins (3)
SKU Description Size Price
LC403659 Lyophilized IDO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403659 Transient overexpression lysate of indoleamine 2,3-dioxygenase 2 (IDO2) (as WB positive control) 100 ug
$665.00
TP323337 Recombinant protein of human indoleamine 2,3-dioxygenase 2 (IDO2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products