NUDT9 (NM_024047) Human Mass Spec Standard

SKU
PH322894
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_076952)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222894]
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC222894 representing NM_024047
Red=Cloning site Green=Tags(s)

MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY
PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY
EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW
AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM
ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076952
RefSeq Size 1716
RefSeq ORF 1050
Synonyms NUDT10
Locus ID 53343
UniProt ID Q9BW91
Cytogenetics 4q22.1
Summary The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Ion Channels: Other
Protein Pathways Purine metabolism
Write Your Own Review
You're reviewing:NUDT9 (NM_024047) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300952 NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155) 10 ug
$3,255.00
LC402975 NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405100 NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402975 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 100 ug
$436.00
LY405100 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3 100 ug
$436.00
TP300952 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322894 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.