NUDT9 (NM_024047) Human Tagged ORF Clone

SKU
RC222894
NUDT9 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT9
Synonyms NUDT10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222894 representing NM_024047
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGACGCCTCCTGGGAAAGGCTTTAGCCGCGGTGTCTCTCTCTCTGGCCTTGGCCTCTGTGACTA
TCAGGTCCTCGCGCTGCCGCGGCATCCAGGCGTTCAGAAACTCGTTTTCATCTTCTTGGTTTCATCTTAA
TACCAACGTCATGTCTGGTTCTAATGGTTCCAAAGAAAATTCTCACAATAAGGCTCGGACGTCTCCTTAC
CCAGGTTCAAAAGTTGAACGAAGCCAGGTTCCTAATGAGAAAGTGGGCTGGCTTGTTGAGTGGCAAGACT
ATAAGCCTGTGGAATACACTGCAGTCTCTGTCTTGGCTGGACCCAGGTGGGCAGATCCTCAGATCAGTGA
AAGTAATTTTTCTCCCAAGTTTAACGAAAAGGATGGGCATGTTGAGAGAAAGAGCAAGAATGGCCTGTAT
GAGATTGAAAATGGAAGACCGAGAAATCCTGCAGGACGGACTGGACTGGTGGGCCGGGGGCTTTTGGGGC
GATGGGGCCCAAATCACGCTGCAGATCCCATTATAACCAGATGGAAAAGGGATAGCAGTGGAAATAAAAT
CATGCATCCTGTTTCTGGGAAGCATATCTTACAATTTGTTGCAATAAAAAGGAAAGACTGTGGAGAATGG
GCAATCCCAGGGGGGATGGTGGATCCAGGAGAGAAGATTAGTGCCACACTGAAAAGAGAATTTGGTGAGG
AAGCTCTCAACTCCTTACAGAAAACCAGTGCTGAGAAGAGAGAAATAGAGGAAAAGTTGCACAAACTCTT
CAGCCAAGACCACCTAGTGATATATAAGGGATATGTTGATGATCCTCGAAACACTGATAATGCATGGATG
GAGACAGAAGCTGTGAACTACCATGACGAAACAGGTGAGATAATGGATAATCTTATGCTAGAAGCTGGAG
ATGATGCTGGAAAAGTGAAATGGGTGGACATCAATGATAAACTGAAGCTTTATGCCAGTCACTCTCAATT
CATCAAACTTGTGGCTGAGAAACGAGATGCACACTGGAGCGAGGACTCTGAAGCTGACTGCCATGCGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222894 representing NM_024047
Red=Cloning site Green=Tags(s)

MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY
PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY
EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW
AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM
ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024047
ORF Size 1050 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024047.5
RefSeq Size 1716 bp
RefSeq ORF 1053 bp
Locus ID 53343
UniProt ID Q9BW91
Cytogenetics 4q22.1
Domains NUDIX
Protein Families Druggable Genome, Ion Channels: Other
Protein Pathways Purine metabolism
MW 38.9 kDa
Summary The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:NUDT9 (NM_024047) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222894L1 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC222894L2 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged 10 ug
$757.00
RC222894L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC222894L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged 10 ug
$757.00
RG222894 NUDT9 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC112300 NUDT9 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.