Sprouty 1 (SPRY1) (NM_199327) Human Mass Spec Standard

SKU
PH322860
SPRY1 MS Standard C13 and N15-labeled recombinant protein (NP_955359)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222860]
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC222860 protein sequence
Red=Cloning site Green=Tags(s)

MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR
QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP
PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC
SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL
KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_955359
RefSeq Size 2380
RefSeq ORF 957
Synonyms hSPRY1
Locus ID 10252
UniProt ID O43609
Cytogenetics 4q28.1
Summary May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Jak-STAT signaling pathway
Write Your Own Review
You're reviewing:Sprouty 1 (SPRY1) (NM_199327) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401771 SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404622 SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401771 Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 1 100 ug
$436.00
LY404622 Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2 100 ug
$436.00
TP322860 Purified recombinant protein of Homo sapiens sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.