Sprouty 1 (SPRY1) Rabbit Polyclonal Antibody

SKU TA339691

Rabbit Polyclonal Anti-SPRY1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPRY1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRY1. Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: sprouty RTK signaling antagonist 1
• Database Link:
  NP_005832
  O43609
• Background: SPRY1 belongs to the sprouty family. It contains 1 SPR (sprouty) domain. SPRY1 may function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.
• Synonyms: hSPRY1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Jak-STAT signaling pathway