PPM1B (NM_177968) Human Mass Spec Standard

SKU
PH322782
PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222782]
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC222782 representing NM_177968
Red=Cloning site Green=Tags(s)

MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL
PPGGGLAGKRNVIEAVYSRLNPHRESDGGAGDLEDPW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_808907
RefSeq Size 3850
RefSeq ORF 1161
Synonyms PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX
Locus ID 5495
UniProt ID O75688
Cytogenetics 2p21
Summary The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Phosphatase, Stem cell - Pluripotency
Protein Pathways MAPK signaling pathway
Write Your Own Review
You're reviewing:PPM1B (NM_177968) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309425 PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808908) 10 ug
$3,255.00
PH312918 PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_002697) 10 ug
$3,255.00
LC406063 PPM1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419156 PPM1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422387 PPM1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406063 Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2 100 ug
$436.00
LY419156 Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1 100 ug
$665.00
LY422387 Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 4 100 ug
$436.00
TP309425 Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 3, 20 µg 20 ug
$867.00
TP312918 Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1, 20 µg 20 ug
$867.00
TP322782 Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.