Flt3 ligand (FLT3LG) (NM_001459) Human Mass Spec Standard

SKU PH322242

FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC222242]
• Predicted MW: 26.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC222242 protein sequence; Red=Cloning site Green=Tags(s); ; MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC; GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA; LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT; RRRTPRPGEQVPPVPSPQDLLLVEH; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001450
• RefSeq Size: 1074
• RefSeq ORF: 705
• Synonyms: FL; FLG3L; FLT3L
• Locus ID: 2323
• UniProt ID: P49771
• Cytogenetics: 19q13.33
• Summary: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer