FAM9C (NM_174901) Human Mass Spec Standard

SKU
PH322158
FAM9C MS Standard C13 and N15-labeled recombinant protein (NP_777561)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222158]
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC222158 protein sequence
Red=Cloning site Green=Tags(s)

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG
EKEEQIKIFQEQQKRWQQDGKGTERD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777561
RefSeq Size 1255
RefSeq ORF 498
Synonyms TEX39C
Locus ID 171484
UniProt ID Q8IZT9
Cytogenetics Xp22.2
Summary This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:FAM9C (NM_174901) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406386 FAM9C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406386 Transient overexpression lysate of family with sequence similarity 9, member C (FAM9C) 100 ug
$436.00
TP322158 Recombinant protein of human family with sequence similarity 9, member C (FAM9C), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.