FAM9C (NM_174901) Human Tagged ORF Clone

SKU
RC222158
FAM9C (Myc-DDK-tagged)-Human family with sequence similarity 9, member C (FAM9C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAM9C
Synonyms TEX39C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222158 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCAAGGACCAGTTGGAGGTTCAAGTTATGGCCGCCCAGGAAATGGAGCTTGCAGGAAAGGATC
CAGTAAGTCATGAGCATGAGGAAAGAAAACCTGTTACAGAGACAAAGGAGGGAGATGTAACTGATGAGCA
TGGGGAAAGAGGATCTTTTGCTGAAACAGATGAACACACGGGGGTTGATACCAAGGAGCTAGAAGATATT
GCAGCTGACATTAAAGAGCATCTTGCTGCAAAGAGAAAAAGGATTGAAAAGATTGCAAAAGCTTGCAGCG
AAATAAAGAACAGAATTAAAAATGTTTTGAGAACAACACAACTAAAAAGGCAGAAACGTGATTATAGAAT
TTCTCTGAAGTTGCCGAATGTCCTTGAAGAGTTCATCACAGATGAGCAGAAAGATGAGGAAGGAGATGGA
GAAAAGGAAGAACAAATTAAAATATTTCAAGAGCAACAAAAGAGGTGGCAACAAGATGGGAAAGGAACTG
AAAGAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222158 protein sequence
Red=Cloning site Green=Tags(s)

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG
EKEEQIKIFQEQQKRWQQDGKGTERD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_174901
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174901.6
RefSeq Size 1255 bp
RefSeq ORF 501 bp
Locus ID 171484
UniProt ID Q8IZT9
Cytogenetics Xp22.2
MW 19.2 kDa
Summary This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:FAM9C (NM_174901) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222158L3 Lenti ORF clone of Human family with sequence similarity 9, member C (FAM9C), Myc-DDK-tagged 10 ug
$450.00
RC222158L4 Lenti ORF clone of Human family with sequence similarity 9, member C (FAM9C), mGFP tagged 10 ug
$450.00
RG222158 FAM9C (tGFP-tagged) - Human family with sequence similarity 9, member C (FAM9C) 10 ug
$489.00
SC309740 FAM9C (untagged)-Human family with sequence similarity 9, member C (FAM9C) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.