OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD44 (NM_000610) Human Mass Spec Standard

Be the first to review this product
SKU
PH321771
CD44 MS Standard C13 and N15-labeled recombinant protein (NP_000601)
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506726 CD44 mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)
100 ul
$447.00
LY400203 Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 1 (as WB positive control)
100 ug
$665.00

Other products for "CD44 or NM_000610"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221771
Predicted MW 81.54 kDa
Protein Sequence
Protein Sequence
>RC221771 representing NM_000610
Red=Cloning site Green=Tags(s)

MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL
SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD
GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP
WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE
ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN
GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG
LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY
TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS
QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN
GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000601
RefSeq Size 5748
RefSeq ORF 2226
Synonyms CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1
Locus ID 960
UniProt ID P16070
Cytogenetics 11p13
Summary The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. provided by RefSeq, Jul 2008
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
Protein Pathways ECM-receptor interaction, Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD44" proteins (10)
SKU Description Size Price
PH302455 CD44 MS Standard C13 and N15-labeled recombinant protein (NP_001001389) 10 ug
$3,360.00
LC400203 Lyophilized CD44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424332 Lyophilized CD44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424334 Lyophilized CD44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400203 Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY424332 Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424334 Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP302455 Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 2, 20 µg 20 ug
$867.00
TP321771 Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1, 20 µg 20 ug
$867.00
TP720465 Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products