OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NGF (NM_002506) Human Mass Spec Standard

Be the first to review this product
SKU
PH321463
NGF MS Standard C13 and N15-labeled recombinant protein (NP_002497)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA349414 Rabbit Polyclonal Anti-NGF Antibody
100 ul
$205.00

Other products for "NGF or NM_002506"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221463
Predicted MW 26.99 kDa
Protein Sequence
Protein Sequence
>RC221463 representing NM_002506
Red=Cloning site Green=Tags(s)

MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI
TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVS
VWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKA
LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002497
RefSeq Size 1052
RefSeq ORF 723
Synonyms Beta-NGF; HSAN5; NGFB
Locus ID 4803
UniProt ID P01138
Cytogenetics 1p13.2
Summary This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Apoptosis, MAPK signaling pathway, Neurotrophin signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NGF" proteins (3)
SKU Description Size Price
TP321463 Recombinant protein of human nerve growth factor (beta polypeptide) (NGF), 20 µg 20 ug
$867.00
TP720591 Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) 10 ug
$275.00
TP721236 Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products