OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIGIT (NM_173799) Human Mass Spec Standard

Be the first to review this product
SKU
PH321447
TIGIT MS Standard C13 and N15-labeled recombinant protein (NP_776160)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812567 TIGIT mouse monoclonal antibody,clone OTI5G1 100 ul
$447.00
LY406575 Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) (as WB positive control) 100 ug
$436.00

Other products for "TIGIT or NM_173799"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221447
Predicted MW 26.3 kDa
Protein Sequence
Protein Sequence
>RC221447 protein sequence
Red=Cloning site Green=Tags(s)

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN
ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI
PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL
CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776160
RefSeq Size 2978
RefSeq ORF 732
Synonyms VSIG9; VSTM3; WUCAM
Locus ID 201633
UniProt ID Q495A1
Cytogenetics 3q13.31
Summary This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.provided by RefSeq, Sep 2009
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIGIT" proteins (7)
SKU Description Size Price
LC406575 Lyophilized TIGIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406575 Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) (as WB positive control) 100 ug
$436.00
TP321447 Recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), 20 µg 20 ug
$737.00
TP700214 Purified recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP723994 Recombinant human TIGIT Protein with C-terminal human Fc tag 100 ug
$825.00
TP724032 Recombinant human TIGIT Protein with C-terminal mouse Fc tag 100 ug
$770.00
TP724033 Recombinant human TIGIT Protein with C-terminal His tag 100 ug
$770.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products