ACOT1 (NM_001037161) Human Mass Spec Standard

SKU
PH321302
ACOT1 MS Standard C13 and N15-labeled recombinant protein (NP_001032238)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221302]
Predicted MW 46.1 kDa
Protein Sequence
Protein Sequence
>RC221302 representing NM_001037161
Red=Cloning site Green=Tags(s)

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGG
SFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVR
AGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEE
AVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRN
RIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032238
RefSeq Size 1603
RefSeq ORF 1263
Synonyms ACH2; CTE-1; LACH2
Locus ID 641371
UniProt ID Q86TX2
Cytogenetics 14q24.3
Summary Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating intracellular levels of acyl-CoAs, free fatty acids and CoASH. More active towards saturated and unsaturated long chain fatty acyl-CoAs (C12-C20).[UniProtKB/Swiss-Prot Function]
Protein Pathways Biosynthesis of unsaturated fatty acids
Write Your Own Review
You're reviewing:ACOT1 (NM_001037161) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400415 ACOT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400415 Transient overexpression lysate of acyl-CoA thioesterase 1 (ACOT1) 100 ug
$665.00
TP321302 Recombinant protein of human acyl-CoA thioesterase 1 (ACOT1), 20 µg 20 ug
$737.00
TP760829 Purified recombinant protein of Human acyl-CoA thioesterase 1 (ACOT1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.