EEF1B2 (NM_001959) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221264] |
Predicted MW | 24.6 kDa |
Protein Sequence |
Protein Sequence
>RC221264 representing NM_001959
Red=Cloning site Green=Tags(s) MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF EDYVQSMDVAAFNKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001950 |
RefSeq Size | 961 |
RefSeq ORF | 675 |
Synonyms | EEF1B; EEF1B1; EF1B |
Locus ID | 1933 |
UniProt ID | P24534 |
Cytogenetics | 2q33.3 |
Summary | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300733 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944) | 10 ug |
$3,255.00
|
|
PH309768 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) | 10 ug |
$3,255.00
|
|
LC400721 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC412075 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421974 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400721 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 | 100 ug |
$436.00
|
|
LY412075 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2 | 100 ug |
$436.00
|
|
LY421974 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 | 100 ug |
$436.00
|
|
TP300733 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP309768 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321264 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.