EEF1B2 (NM_021121) Human Mass Spec Standard

SKU
PH300733
EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200733]
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC200733 protein sequence
Red=Cloning site Green=Tags(s)

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP
GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS
SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
EDYVQSMDVAAFNKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066944
RefSeq Size 854
RefSeq ORF 675
Synonyms EEF1B; EEF1B1; EF1B
Locus ID 1933
UniProt ID P24534
Cytogenetics 2q33.3
Summary This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:EEF1B2 (NM_021121) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309768 EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) 10 ug
$3,255.00
PH321264 EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001950) 10 ug
$3,255.00
LC400721 EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412075 EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421974 EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400721 Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 100 ug
$436.00
LY412075 Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2 100 ug
$436.00
LY421974 Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 100 ug
$436.00
TP300733 Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP309768 Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321264 Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.