BUB3 (NM_001007793) Human Mass Spec Standard

SKU
PH320961
BUB3 MS Standard C13 and N15-labeled recombinant protein (NP_001007794)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220961]
Predicted MW 37 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC220961
Blue=ORF Red=Cloning site Green=Tag(s)

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTH
AWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPE
KVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEY
LDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYP
TSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKST

myc-FLAG tag

Recombinant protein using RC220961 also available, TP320961
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007794
RefSeq Size 1374
RefSeq ORF 978
Synonyms BUB3L; hBUB3
Locus ID 9184
UniProt ID O43684
Cytogenetics 10q26.13
Summary This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cell cycle
Write Your Own Review
You're reviewing:BUB3 (NM_001007793) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400384 BUB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417795 BUB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429219 BUB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400384 Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2 100 ug
$436.00
LY417795 Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 100 ug
$436.00
LY429219 Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 100 ug
$436.00
TP320961 Recombinant protein of human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.