RAB27A (NM_004580) Human Mass Spec Standard

SKU
PH320897
RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_004571)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220897]
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC220897 protein sequence
Red=Cloning site Green=Tags(s)

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL
QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL
SEEKEKGACGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004571
RefSeq Size 3474
RefSeq ORF 663
Synonyms GS2; HsT18676; RAB27; RAM
Locus ID 5873
UniProt ID P51159
Cytogenetics 15q21.3
Summary The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB27A (NM_004580) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317900 RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899057) 10 ug
$3,255.00
PH319810 RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899058) 10 ug
$3,255.00
PH323511 RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899059) 10 ug
$3,255.00
LC405229 RAB27A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405230 RAB27A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405231 RAB27A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417890 RAB27A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430653 RAB27A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405229 Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 2 100 ug
$436.00
LY405230 Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 3 100 ug
$436.00
LY405231 Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 4 100 ug
$436.00
LY417890 Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 1 100 ug
$436.00
TP317900 Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319810 Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320897 Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323511 Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.