RAB27A (NM_183235) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC219810] |
Predicted MW | 24.9 kDa |
Protein Sequence |
Protein Sequence
>RC219810 representing NM_183235
Red=Cloning site Green=Tags(s) MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL SEEKEKGACGC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_899058 |
RefSeq Size | 3464 |
RefSeq ORF | 663 |
Synonyms | GS2; HsT18676; RAB27; RAM |
Locus ID | 5873 |
UniProt ID | P51159 |
Cytogenetics | 15q21.3 |
Summary | The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317900 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899057) | 10 ug |
$3,255.00
|
|
PH320897 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_004571) | 10 ug |
$3,255.00
|
|
PH323511 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899059) | 10 ug |
$3,255.00
|
|
LC405229 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405230 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405231 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417890 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430653 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405229 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 2 | 100 ug |
$436.00
|
|
LY405230 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 3 | 100 ug |
$436.00
|
|
LY405231 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 4 | 100 ug |
$436.00
|
|
LY417890 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 1 | 100 ug |
$436.00
|
|
TP317900 | Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP319810 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP320897 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323511 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.