ST13 (NM_003932) Human Mass Spec Standard

SKU
PH320533
ST13 MS Standard C13 and N15-labeled recombinant protein (NP_003923)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220533]
Predicted MW 41.2 kDa
Protein Sequence
Protein Sequence
>RC220533 representing NM_003932
Red=Cloning site Green=Tags(s)

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS
NPKVMNLISKLSAKFGGQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003923
RefSeq Size 3214
RefSeq ORF 1107
Synonyms AAG2; FAM10A1; FAM10A4; HIP; HOP; HSPABP; HSPABP1; P48; PRO0786; SNC6
Locus ID 6767
UniProt ID P50502
Cytogenetics 22q13.2
Summary The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ST13 (NM_003932) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418342 ST13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418342 Transient overexpression lysate of suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13) 100 ug
$436.00
TP320533 Recombinant protein of human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.