ST13 (NM_003932) Human Tagged ORF Clone

SKU
RC220533
ST13 (Myc-DDK-tagged)-Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ST13
Synonyms AAG2; FAM10A1; FAM10A4; HIP; HOP; HSPABP; HSPABP1; P48; PRO0786; SNC6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220533 representing NM_003932
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCCGCAAAGTGAACGAGCTTCGGGCCTTTGTGAAAATGTGTAAGCAGGATCCGAGCGTTCTGC
ACACCGAGGAAATGCGCTTCCTGAGGGAGTGGGTGGAGAGCATGGGTGGTAAAGTACCACCTGCTACTCA
GAAAGCTAAATCAGAAGAAAATACCAAGGAAGAAAAACCTGATAGTAAGAAGGTGGAGGAAGACTTAAAG
GCAGACGAACCATCAAGTGAGGAAAGTGATCTAGAAATTGATAAAGAAGGTGTGATTGAACCAGACACTG
ATGCTCCTCAAGAAATGGGAGATGAAAATGCGGAGATAACGGAGGAGATGATGGATCAGGCAAATGATAA
AAAAGTGGCTGCTATTGAAGCCCTAAATGATGGTGAACTCCAGAAAGCCATTGACTTATTCACAGATGCC
ATCAAGCTGAATCCTCGCTTGGCCATTTTGTATGCCAAGAGGGCCAGTGTCTTCGTCAAATTACAGAAGC
CAAATGCTGCCATCCGAGACTGTGACAGAGCCATTGAAATAAATCCTGATTCAGCTCAGCCTTACAAGTG
GCGGGGGAAAGCACACAGACTTCTAGGCCACTGGGAAGAAGCAGCCCATGATCTTGCCCTTGCCTGTAAA
TTGGATTATGATGAAGATGCTAGTGCAATGCTGAAAGAAGTTCAACCTAGGGCACAGAAAATTGCAGAAC
ATCGGAGAAAGTATGAGCGAAAACGTGAAGAGCGAGAGATCAAAGAAAGAATAGAACGAGTTAAGAAGGC
TCGAGAAGAGCATGAGAGAGCCCAGAGGGAGGAAGAAGCCAGACGACAGTCAGGAGCTCAGTATGGCTCT
TTTCCAGGTGGCTTTCCTGGGGGAATGCCTGGTAATTTTCCCGGAGGAATGCCTGGAATGGGAGGGGGCA
TGCCTGGAATGGCTGGAATGCCTGGACTCAATGAAATTCTTAGTGATCCAGAGGTTCTTGCAGCCATGCA
GGATCCAGAAGTTATGGTGGCTTTCCAGGATGTGGCTCAGAACCCAGCAAATATGTCAAAATACCAGAGC
AACCCAAAGGTTATGAATCTCATCAGTAAATTGTCAGCCAAATTTGGAGGTCAAGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220533 representing NM_003932
Red=Cloning site Green=Tags(s)

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS
NPKVMNLISKLSAKFGGQA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003932
ORF Size 1107 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003932.5
RefSeq Size 3214 bp
RefSeq ORF 1110 bp
Locus ID 6767
UniProt ID P50502
Cytogenetics 22q13.2
Domains STI1, TPR
Protein Families Druggable Genome
MW 41.2 kDa
Summary The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]
Write Your Own Review
You're reviewing:ST13 (NM_003932) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220533L1 Lenti ORF clone of Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13), Myc-DDK-tagged 10 ug
$986.00
RC220533L2 Lenti ORF clone of Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13), mGFP tagged 10 ug
$986.00
RC220533L3 Lenti ORF clone of Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13), Myc-DDK-tagged 10 ug
$986.00
RC220533L4 Lenti ORF clone of Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13), mGFP tagged 10 ug
$986.00
RG220533 ST13 (tGFP-tagged) - Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13) 10 ug
$886.00
SC117700 ST13 (untagged)-Human suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (ST13) 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.