Calcipressin 1 (RCAN1) (NM_004414) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC220434] |
Predicted MW | 27.9 kDa |
Protein Sequence |
Protein Sequence
>RC220434 representing NM_004414
Red=Cloning site Green=Tags(s) MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004405 |
RefSeq Size | 2457 |
RefSeq ORF | 756 |
Synonyms | ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1 |
Locus ID | 1827 |
UniProt ID | P53805 |
Cytogenetics | 21q22.12 |
Summary | The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403714 | RCAN1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403714 | Transient overexpression lysate of regulator of calcineurin 1 (RCAN1), transcript variant 3 | 100 ug |
$436.00
|
|
TP320434 | Recombinant protein of human regulator of calcineurin 1 (RCAN1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760488 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
TP760720 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.