OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COQ7 (NM_016138) Human Mass Spec Standard

Be the first to review this product
SKU
PH320317
COQ7 MS Standard C13 and N15-labeled recombinant protein (NP_057222)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358592 COQ7 Antibody - C-terminal region
100 ul
$585.00
LY414165 Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) (as WB positive control) 100 ug
$436.00

Other products for "COQ7 or NM_016138"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220317
Predicted MW 24.1 kDa
Protein Sequence
Protein Sequence
>RC220317 representing NM_016138
Red=Cloning site Green=Tags(s)

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ
MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA
VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA
IYLSERL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057222
RefSeq Size 2591
RefSeq ORF 651
Synonyms CAT5; CLK-1; CLK1; COQ10D8
Locus ID 10229
UniProt ID Q99807
Cytogenetics 16p12.3
Summary The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Jul 2010
Protein Pathways Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COQ7" proteins (5)
SKU Description Size Price
LC414165 Lyophilized COQ7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433767 Lyophilized COQ7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414165 Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) (as WB positive control) 100 ug
$436.00
LY433767 Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP320317 Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products