COQ7 (NM_016138) Human Tagged ORF Clone

SKU
RC220317
COQ7 (Myc-DDK-tagged)-Human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COQ7
Synonyms CAT5; CLK-1; CLK1; COQ10D8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220317 representing NM_016138
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTGCGCCGGGGCGGCGGCGGCTCCCCGCCTTTGGCGGCTGCGCCCGGGGGCCCGGCGGTCCCTCT
CAGCTTATGGAAGAAGAACCAGTGTCAGATTTCGCAGTTCAGGAATGACTTTAGACAATATCAGTCGGGC
AGCTGTGGATCGAATAATCCGGGTGGATCATGCAGGCGAATATGGAGCAAACCGCATCTATGCCGGGCAG
ATGGCTGTCCTGGGTCGGACCAGCGTCGGGCCAGTCATTCAGAAAATGTGGGATCAAGAAAAGGACCATT
TGAAAAAGTTCAATGAGTTGATGGTTATGTTCAGGGTCCGGCCAACAGTTCTGATGCCCTTGTGGAACGT
GCTGGGGTTTGCACTGGGGGCGGGGACCGCCTTGCTCGGGAAGGAAGGTGCCATGGCCTGCACCGTGGCG
GTGGAAGAGAGCATAGCACATCACTACAACAACCAGATCAGGACGCTGATGGAGGAGGACCCTGAAAAAT
ACGAGGAACTTCTTCAGCTGATAAAGAAATTTCGGGATGAAGAGCTTGAGCACCATGACATAGGCCTCGA
CCATGATGCAGAATTGGCTCCAGCCTATGCCGTCCTGAAGAGCATTATCCAGGCCGGATGCAGAGTGGCG
ATATATTTATCAGAAAGATTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220317 representing NM_016138
Red=Cloning site Green=Tags(s)

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ
MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA
VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA
IYLSERL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016138
ORF Size 651 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016138.2
RefSeq Size 2591 bp
RefSeq ORF 654 bp
Locus ID 10229
UniProt ID Q99807
Cytogenetics 16p12.3
Domains COQ7
Protein Pathways Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis
MW 24.1 kDa
Summary The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:COQ7 (NM_016138) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220317L3 Lenti ORF clone of Human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220317L4 Lenti ORF clone of Human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 1, mGFP tagged 10 ug
$600.00
RG220317 COQ7 (tGFP-tagged) - Human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114477 COQ7 (untagged)-Human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.